Anti IFIT1 pAb (ATL-HPA055380)

Atlas Antibodies

Catalog No.:
ATL-HPA055380-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: interferon-induced protein with tetratricopeptide repeats 1
Gene Name: IFIT1
Alternative Gene Name: G10P1, GARG-16, IFI56, IFNAI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079339: 44%, ENSRNOG00000036603: 46%
Entrez Gene ID: 3434
Uniprot ID: P09914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH
Gene Sequence KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH
Gene ID - Mouse ENSMUSG00000079339
Gene ID - Rat ENSRNOG00000036603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IFIT1 pAb (ATL-HPA055380)
Datasheet Anti IFIT1 pAb (ATL-HPA055380) Datasheet (External Link)
Vendor Page Anti IFIT1 pAb (ATL-HPA055380) at Atlas Antibodies

Documents & Links for Anti IFIT1 pAb (ATL-HPA055380)
Datasheet Anti IFIT1 pAb (ATL-HPA055380) Datasheet (External Link)
Vendor Page Anti IFIT1 pAb (ATL-HPA055380)
Citations for Anti IFIT1 pAb (ATL-HPA055380) – 3 Found
Ohsugi, Tomoyuki; Yamaguchi, Kiyoshi; Zhu, Chi; Ikenoue, Tsuneo; Furukawa, Yoichi. Decreased expression of interferon-induced protein 2 (IFIT2) by Wnt/β-catenin signaling confers anti-apoptotic properties to colorectal cancer cells. Oncotarget. 2017;8(59):100176-100186.  PubMed
Pflügler, Sandra; Svinka, Jasmin; Scharf, Irene; Crncec, Ilija; Filipits, Martin; Charoentong, Pornpimol; Tschurtschenthaler, Markus; Kenner, Lukas; Awad, Monira; Stift, Judith; Schernthanner, Marina; Bischl, Romana; Herndler-Brandstetter, Dietmar; Glitzner, Elisabeth; Moll, Herwig P; Casanova, Emilio; Timelthaler, Gerald; Sibilia, Maria; Gnant, Michael; Lax, Sigurd; Thaler, Josef; Müller, Mathias; Strobl, Birgit; Mohr, Thomas; Kaser, Arthur; Trajanoski, Zlatko; Heller, Gerwin; Eferl, Robert. IDO1(+) Paneth cells promote immune escape of colorectal cancer. Communications Biology. 2020;3(1):252.  PubMed
Mähönen, Katariina; Hau, Annika; Bondet, Vincent; Duffy, Darragh; Eklund, Kari K; Panelius, Jaana; Ranki, Annamari. Activation of NLRP3 Inflammasome in the Skin of Patients with Systemic and Cutaneous Lupus Erythematosus. Acta Dermato-Venereologica. 2022;102( 35356994):adv00708.  PubMed