Anti IFI44L pAb (ATL-HPA053247)

Atlas Antibodies

Catalog No.:
ATL-HPA053247-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: interferon-induced protein 44-like
Gene Name: IFI44L
Alternative Gene Name: C1orf29, GS3686
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061175: 28%, ENSRNOG00000049994: 30%
Entrez Gene ID: 10964
Uniprot ID: Q53G44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSVHGGSIEDMVERCSRQGCTITMAYIDYNMIVAFMLGNYINLHESSTEPNDSLWFSLQKKNDTTEIETLLLNTAP
Gene Sequence SSVHGGSIEDMVERCSRQGCTITMAYIDYNMIVAFMLGNYINLHESSTEPNDSLWFSLQKKNDTTEIETLLLNTAP
Gene ID - Mouse ENSMUSG00000061175
Gene ID - Rat ENSRNOG00000049994
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IFI44L pAb (ATL-HPA053247)
Datasheet Anti IFI44L pAb (ATL-HPA053247) Datasheet (External Link)
Vendor Page Anti IFI44L pAb (ATL-HPA053247) at Atlas Antibodies

Documents & Links for Anti IFI44L pAb (ATL-HPA053247)
Datasheet Anti IFI44L pAb (ATL-HPA053247) Datasheet (External Link)
Vendor Page Anti IFI44L pAb (ATL-HPA053247)