Anti IFI44 pAb (ATL-HPA027148)

Atlas Antibodies

Catalog No.: ATL-HPA027148-25

Protein Description: interferon-induced protein 44
Gene Name: IFI44
Alternative Gene Name: MTAP44, p44, TLDC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028037: 43%, ENSRNOG00000022218: 38%
Entrez Gene ID: 10561
Uniprot ID: Q8TCB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGP
• Gene Sequence: PTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGP
• Gene ID - Mouse: ENSMUSG00000028037
• Gene ID - Rat: ENSRNOG00000022218
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.