Anti IFFO1 pAb (ATL-HPA069344)

Atlas Antibodies

Catalog No.:
ATL-HPA069344-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: intermediate filament family orphan 1
Gene Name: IFFO1
Alternative Gene Name: HOM-TES-103, IFFO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038271: 100%, ENSRNOG00000018533: 100%
Entrez Gene ID: 25900
Uniprot ID: Q0D2I5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTR
Gene Sequence LLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTR
Gene ID - Mouse ENSMUSG00000038271
Gene ID - Rat ENSRNOG00000018533
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IFFO1 pAb (ATL-HPA069344)
Datasheet Anti IFFO1 pAb (ATL-HPA069344) Datasheet (External Link)
Vendor Page Anti IFFO1 pAb (ATL-HPA069344) at Atlas Antibodies

Documents & Links for Anti IFFO1 pAb (ATL-HPA069344)
Datasheet Anti IFFO1 pAb (ATL-HPA069344) Datasheet (External Link)
Vendor Page Anti IFFO1 pAb (ATL-HPA069344)