Anti IFFO1 pAb (ATL-HPA069344)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069344-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: IFFO1
Alternative Gene Name: HOM-TES-103, IFFO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038271: 100%, ENSRNOG00000018533: 100%
Entrez Gene ID: 25900
Uniprot ID: Q0D2I5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTR |
Gene Sequence | LLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTR |
Gene ID - Mouse | ENSMUSG00000038271 |
Gene ID - Rat | ENSRNOG00000018533 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IFFO1 pAb (ATL-HPA069344) | |
Datasheet | Anti IFFO1 pAb (ATL-HPA069344) Datasheet (External Link) |
Vendor Page | Anti IFFO1 pAb (ATL-HPA069344) at Atlas Antibodies |
Documents & Links for Anti IFFO1 pAb (ATL-HPA069344) | |
Datasheet | Anti IFFO1 pAb (ATL-HPA069344) Datasheet (External Link) |
Vendor Page | Anti IFFO1 pAb (ATL-HPA069344) |