Anti IFFO1 pAb (ATL-HPA069344)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069344-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: IFFO1
Alternative Gene Name: HOM-TES-103, IFFO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038271: 100%, ENSRNOG00000018533: 100%
Entrez Gene ID: 25900
Uniprot ID: Q0D2I5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTR |
| Gene Sequence | LLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTR |
| Gene ID - Mouse | ENSMUSG00000038271 |
| Gene ID - Rat | ENSRNOG00000018533 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IFFO1 pAb (ATL-HPA069344) | |
| Datasheet | Anti IFFO1 pAb (ATL-HPA069344) Datasheet (External Link) |
| Vendor Page | Anti IFFO1 pAb (ATL-HPA069344) at Atlas Antibodies |
| Documents & Links for Anti IFFO1 pAb (ATL-HPA069344) | |
| Datasheet | Anti IFFO1 pAb (ATL-HPA069344) Datasheet (External Link) |
| Vendor Page | Anti IFFO1 pAb (ATL-HPA069344) |