Anti IER3IP1 pAb (ATL-HPA010027)

Atlas Antibodies

Catalog No.: ATL-HPA010027-100

Protein Description: immediate early response 3 interacting protein 1
Gene Name: IER3IP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025421: 100%, ENSRNOG00000043171: 98%
Entrez Gene ID: 51124
Uniprot ID: Q9Y5U9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT
• Gene Sequence: IAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT
• Gene ID - Mouse: ENSMUSG00000025421
• Gene ID - Rat: ENSRNOG00000043171
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IER3IP1 pAb (ATL-HPA010027) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.