Anti IER3IP1 pAb (ATL-HPA010027)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010027-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: IER3IP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025421: 100%, ENSRNOG00000043171: 98%
Entrez Gene ID: 51124
Uniprot ID: Q9Y5U9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT |
| Gene Sequence | IAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT |
| Gene ID - Mouse | ENSMUSG00000025421 |
| Gene ID - Rat | ENSRNOG00000043171 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IER3IP1 pAb (ATL-HPA010027) | |
| Datasheet | Anti IER3IP1 pAb (ATL-HPA010027) Datasheet (External Link) |
| Vendor Page | Anti IER3IP1 pAb (ATL-HPA010027) at Atlas Antibodies |
| Documents & Links for Anti IER3IP1 pAb (ATL-HPA010027) | |
| Datasheet | Anti IER3IP1 pAb (ATL-HPA010027) Datasheet (External Link) |
| Vendor Page | Anti IER3IP1 pAb (ATL-HPA010027) |
| Citations for Anti IER3IP1 pAb (ATL-HPA010027) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |