Anti IER2 pAb (ATL-HPA060574)

Atlas Antibodies

Catalog No.:
ATL-HPA060574-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: immediate early response 2
Gene Name: IER2
Alternative Gene Name: ETR101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053560: 83%, ENSRNOG00000005038: 32%
Entrez Gene ID: 9592
Uniprot ID: Q9BTL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DAGLVPSKKARLEEKEEEEGASSEVADRLQPPPAQAEGAFPNLARVLQRRFSGLLNCS
Gene Sequence DAGLVPSKKARLEEKEEEEGASSEVADRLQPPPAQAEGAFPNLARVLQRRFSGLLNCS
Gene ID - Mouse ENSMUSG00000053560
Gene ID - Rat ENSRNOG00000005038
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IER2 pAb (ATL-HPA060574)
Datasheet Anti IER2 pAb (ATL-HPA060574) Datasheet (External Link)
Vendor Page Anti IER2 pAb (ATL-HPA060574) at Atlas Antibodies

Documents & Links for Anti IER2 pAb (ATL-HPA060574)
Datasheet Anti IER2 pAb (ATL-HPA060574) Datasheet (External Link)
Vendor Page Anti IER2 pAb (ATL-HPA060574)