Anti IER2 pAb (ATL-HPA060574)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060574-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: IER2
Alternative Gene Name: ETR101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053560: 83%, ENSRNOG00000005038: 32%
Entrez Gene ID: 9592
Uniprot ID: Q9BTL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DAGLVPSKKARLEEKEEEEGASSEVADRLQPPPAQAEGAFPNLARVLQRRFSGLLNCS |
Gene Sequence | DAGLVPSKKARLEEKEEEEGASSEVADRLQPPPAQAEGAFPNLARVLQRRFSGLLNCS |
Gene ID - Mouse | ENSMUSG00000053560 |
Gene ID - Rat | ENSRNOG00000005038 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IER2 pAb (ATL-HPA060574) | |
Datasheet | Anti IER2 pAb (ATL-HPA060574) Datasheet (External Link) |
Vendor Page | Anti IER2 pAb (ATL-HPA060574) at Atlas Antibodies |
Documents & Links for Anti IER2 pAb (ATL-HPA060574) | |
Datasheet | Anti IER2 pAb (ATL-HPA060574) Datasheet (External Link) |
Vendor Page | Anti IER2 pAb (ATL-HPA060574) |