Anti IDUA pAb (ATL-HPA046979)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046979-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: IDUA
Alternative Gene Name: MPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033540: 86%, ENSRNOG00000000043: 85%
Entrez Gene ID: 3425
Uniprot ID: P35475
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGE |
Gene Sequence | VFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGE |
Gene ID - Mouse | ENSMUSG00000033540 |
Gene ID - Rat | ENSRNOG00000000043 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IDUA pAb (ATL-HPA046979) | |
Datasheet | Anti IDUA pAb (ATL-HPA046979) Datasheet (External Link) |
Vendor Page | Anti IDUA pAb (ATL-HPA046979) at Atlas Antibodies |
Documents & Links for Anti IDUA pAb (ATL-HPA046979) | |
Datasheet | Anti IDUA pAb (ATL-HPA046979) Datasheet (External Link) |
Vendor Page | Anti IDUA pAb (ATL-HPA046979) |