Anti IDS pAb (ATL-HPA078003)

Atlas Antibodies

Catalog No.:
ATL-HPA078003-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: iduronate 2-sulfatase
Gene Name: IDS
Alternative Gene Name: SIDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035847: 98%, ENSRNOG00000001465: 98%
Entrez Gene ID: 3423
Uniprot ID: P22304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVG
Gene Sequence TGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVG
Gene ID - Mouse ENSMUSG00000035847
Gene ID - Rat ENSRNOG00000001465
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IDS pAb (ATL-HPA078003)
Datasheet Anti IDS pAb (ATL-HPA078003) Datasheet (External Link)
Vendor Page Anti IDS pAb (ATL-HPA078003) at Atlas Antibodies

Documents & Links for Anti IDS pAb (ATL-HPA078003)
Datasheet Anti IDS pAb (ATL-HPA078003) Datasheet (External Link)
Vendor Page Anti IDS pAb (ATL-HPA078003)