Anti IDO2 pAb (ATL-HPA054911)

Atlas Antibodies

Catalog No.:
ATL-HPA054911-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: indoleamine 2,3-dioxygenase 2
Gene Name: IDO2
Alternative Gene Name: INDOL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031549: 56%, ENSRNOG00000031189: 36%
Entrez Gene ID: 169355
Uniprot ID: Q6ZQW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAHQLQAHVDKMP
Gene Sequence FHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAHQLQAHVDKMP
Gene ID - Mouse ENSMUSG00000031549
Gene ID - Rat ENSRNOG00000031189
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IDO2 pAb (ATL-HPA054911)
Datasheet Anti IDO2 pAb (ATL-HPA054911) Datasheet (External Link)
Vendor Page Anti IDO2 pAb (ATL-HPA054911) at Atlas Antibodies

Documents & Links for Anti IDO2 pAb (ATL-HPA054911)
Datasheet Anti IDO2 pAb (ATL-HPA054911) Datasheet (External Link)
Vendor Page Anti IDO2 pAb (ATL-HPA054911)