Anti IDNK pAb (ATL-HPA058429)

Atlas Antibodies

Catalog No.: ATL-HPA058429-25

Protein Description: idnK, gluconokinase homolog (E. coli)
Gene Name: IDNK
Alternative Gene Name: bA522I20.2, C9orf103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050002: 53%, ENSRNOG00000019519: 55%
Entrez Gene ID: 414328
Uniprot ID: Q5T6J7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGH
• Gene Sequence: RDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGH
• Gene ID - Mouse: ENSMUSG00000050002
• Gene ID - Rat: ENSRNOG00000019519
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.