Anti IDH3G pAb (ATL-HPA002017)

Atlas Antibodies

Catalog No.: ATL-HPA002017-25

Protein Description: isocitrate dehydrogenase 3 (NAD+) gamma
Gene Name: IDH3G
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002010: 100%, ENSRNOG00000055572: 100%
Entrez Gene ID: 3421
Uniprot ID: P51553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAA
• Gene Sequence: ADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAA
• Gene ID - Mouse: ENSMUSG00000002010
• Gene ID - Rat: ENSRNOG00000055572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IDH3G pAb (ATL-HPA002017) – 3 Found

Fischer, Anthony J; Goss, Kelli L; Scheetz, Todd E; Wohlford-Lenane, Christine L; Snyder, Jeanne M; McCray, Paul B Jr. Differential gene expression in human conducting airway surface epithelia and submucosal glands. American Journal Of Respiratory Cell And Molecular Biology. 2009;40(2):189-99. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Kafkia, Eleni; Andres-Pons, Amparo; Ganter, Kerstin; Seiler, Markus; Smith, Tom S; Andrejeva, Anna; Jouhten, Paula; Pereira, Filipa; Franco, Catarina; Kuroshchenkova, Anna; Leone, Sergio; Sawarkar, Ritwick; Boston, Rebecca; Thaventhiran, James; Zaugg, Judith B; Lilley, Kathryn S; Lancrin, Christophe; Beck, Martin; Patil, Kiran Raosaheb. Operation of a TCA cycle subnetwork in the mammalian nucleus. Science Advances. 2022;8(35):eabq5206.