Anti IDH3A pAb (ATL-HPA041465 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041465-25

Protein Description: isocitrate dehydrogenase 3 (NAD+) alpha
Gene Name: IDH3A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032279: 98%, ENSRNOG00000010277: 97%
Entrez Gene ID: 3419
Uniprot ID: P50213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRV
• Gene Sequence: PTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRV
• Gene ID - Mouse: ENSMUSG00000032279
• Gene ID - Rat: ENSRNOG00000010277
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IDH3A pAb (ATL-HPA041465 w/enhanced validation) – 1 Found

May, Jasmine L; Kouri, Fotini M; Hurley, Lisa A; Liu, Juan; Tommasini-Ghelfi, Serena; Ji, Yanrong; Gao, Peng; Calvert, Andrea E; Lee, Andrew; Chandel, Navdeep S; Davuluri, Ramana V; Horbinski, Craig M; Locasale, Jason W; Stegh, Alexander H. IDH3α regulates one-carbon metabolism in glioblastoma. Science Advances. 2019;5(1):eaat0456.