Anti IDH1 pAb (ATL-HPA057936 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA057936-25

• 
• 

Protein Description: isocitrate dehydrogenase 1 (NADP+), soluble
Gene Name: IDH1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025950: 92%, ENSRNOG00000015020: 95%
Entrez Gene ID: 3417
Uniprot ID: O75874
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA
• Gene Sequence: LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA
• Gene ID - Mouse: ENSMUSG00000025950
• Gene ID - Rat: ENSRNOG00000015020
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.