Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035248-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: IDH1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025950: 95%, ENSRNOG00000015020: 95%
Entrez Gene ID: 3417
Uniprot ID: O75874
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY |
| Gene Sequence | FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY |
| Gene ID - Mouse | ENSMUSG00000025950 |
| Gene ID - Rat | ENSRNOG00000015020 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation) | |
| Datasheet | Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation) | |
| Datasheet | Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation) |
| Citations for Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation) – 3 Found |
| van Lith, Sanne A M; Navis, Anna C; Lenting, Krissie; Verrijp, Kiek; Schepens, Jan T G; Hendriks, Wiljan J A J; Schubert, Nil A; Venselaar, Hanka; Wevers, Ron A; van Rooij, Arno; Wesseling, Pieter; Molenaar, Remco J; van Noorden, Cornelis J F; Pusch, Stefan; Tops, Bastiaan; Leenders, William P J. Identification of a novel inactivating mutation in Isocitrate Dehydrogenase 1 (IDH1-R314C) in a high grade astrocytoma. Scientific Reports. 2016;6( 27460417):30486. PubMed |
| Dahuja, Gitanshu; Gupta, Ashok; Jindal, Arpita; Jain, Gaurav; Sharma, Santosh; Kumar, Arvind. Clinicopathological Correlation of Glioma Patients with respect to Immunohistochemistry Markers: A Prospective Study of 115 Patients in a Tertiary Care Hospital in North India. Asian Journal Of Neurosurgery. 2021;16(4):732-737. PubMed |
| O'Dwyer, Donna; Ralton, Lynda D; O'Shea, Aisling; Murray, Graeme I. The proteomics of colorectal cancer: identification of a protein signature associated with prognosis. Plos One. 6(11):e27718. PubMed |