Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035248-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: isocitrate dehydrogenase 1 (NADP+), soluble
Gene Name: IDH1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025950: 95%, ENSRNOG00000015020: 95%
Entrez Gene ID: 3417
Uniprot ID: O75874
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
Gene Sequence FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
Gene ID - Mouse ENSMUSG00000025950
Gene ID - Rat ENSRNOG00000015020
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation)
Datasheet Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation)
Datasheet Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation)
Citations for Anti IDH1 pAb (ATL-HPA035248 w/enhanced validation) – 3 Found
van Lith, Sanne A M; Navis, Anna C; Lenting, Krissie; Verrijp, Kiek; Schepens, Jan T G; Hendriks, Wiljan J A J; Schubert, Nil A; Venselaar, Hanka; Wevers, Ron A; van Rooij, Arno; Wesseling, Pieter; Molenaar, Remco J; van Noorden, Cornelis J F; Pusch, Stefan; Tops, Bastiaan; Leenders, William P J. Identification of a novel inactivating mutation in Isocitrate Dehydrogenase 1 (IDH1-R314C) in a high grade astrocytoma. Scientific Reports. 2016;6( 27460417):30486.  PubMed
Dahuja, Gitanshu; Gupta, Ashok; Jindal, Arpita; Jain, Gaurav; Sharma, Santosh; Kumar, Arvind. Clinicopathological Correlation of Glioma Patients with respect to Immunohistochemistry Markers: A Prospective Study of 115 Patients in a Tertiary Care Hospital in North India. Asian Journal Of Neurosurgery. 2021;16(4):732-737.  PubMed
O'Dwyer, Donna; Ralton, Lynda D; O'Shea, Aisling; Murray, Graeme I. The proteomics of colorectal cancer: identification of a protein signature associated with prognosis. Plos One. 6(11):e27718.  PubMed