Anti IDE pAb (ATL-HPA063478)

Atlas Antibodies

SKU:
ATL-HPA063478-100
  • Immunohistochemical staining of human stomach shows membranous and cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: insulin-degrading enzyme
Gene Name: IDE
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111624: 97%, ENSRNOG00000016833: 97%
Entrez Gene ID: 3416
Uniprot ID: P14735
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHP
Gene Sequence EKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHP
Gene ID - Mouse ENSMUSG00000111624
Gene ID - Rat ENSRNOG00000016833
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti IDE pAb (ATL-HPA063478)
Datasheet Anti IDE pAb (ATL-HPA063478) Datasheet (External Link)
Vendor Page Anti IDE pAb (ATL-HPA063478) at Atlas Antibodies

Documents & Links for Anti IDE pAb (ATL-HPA063478)
Datasheet Anti IDE pAb (ATL-HPA063478) Datasheet (External Link)
Vendor Page Anti IDE pAb (ATL-HPA063478)