Anti ICOSLG pAb (ATL-HPA029179)

Atlas Antibodies

Catalog No.:
ATL-HPA029179-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: inducible T-cell costimulator ligand
Gene Name: ICOSLG
Alternative Gene Name: B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000732: 50%, ENSRNOG00000023109: 59%
Entrez Gene ID: 23308
Uniprot ID: O75144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVT
Gene Sequence KEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVT
Gene ID - Mouse ENSMUSG00000000732
Gene ID - Rat ENSRNOG00000023109
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ICOSLG pAb (ATL-HPA029179)
Datasheet Anti ICOSLG pAb (ATL-HPA029179) Datasheet (External Link)
Vendor Page Anti ICOSLG pAb (ATL-HPA029179) at Atlas Antibodies

Documents & Links for Anti ICOSLG pAb (ATL-HPA029179)
Datasheet Anti ICOSLG pAb (ATL-HPA029179) Datasheet (External Link)
Vendor Page Anti ICOSLG pAb (ATL-HPA029179)