Anti ICOS pAb (ATL-HPA034865)

Atlas Antibodies

Catalog No.:
ATL-HPA034865-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: inducible T cell costimulator
Gene Name: ICOS
Alternative Gene Name: AILIM, CD278
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103068: 70%, ENSRNOG00000046196: 70%
Entrez Gene ID: 29851
Uniprot ID: Q9Y6W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIK
Gene Sequence INGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIK
Gene ID - Mouse ENSMUSG00000103068
Gene ID - Rat ENSRNOG00000046196
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ICOS pAb (ATL-HPA034865)
Datasheet Anti ICOS pAb (ATL-HPA034865) Datasheet (External Link)
Vendor Page Anti ICOS pAb (ATL-HPA034865) at Atlas Antibodies

Documents & Links for Anti ICOS pAb (ATL-HPA034865)
Datasheet Anti ICOS pAb (ATL-HPA034865) Datasheet (External Link)
Vendor Page Anti ICOS pAb (ATL-HPA034865)