Anti ICOS pAb (ATL-HPA034865)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034865-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ICOS
Alternative Gene Name: AILIM, CD278
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103068: 70%, ENSRNOG00000046196: 70%
Entrez Gene ID: 29851
Uniprot ID: Q9Y6W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | INGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIK |
| Gene Sequence | INGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIK |
| Gene ID - Mouse | ENSMUSG00000103068 |
| Gene ID - Rat | ENSRNOG00000046196 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ICOS pAb (ATL-HPA034865) | |
| Datasheet | Anti ICOS pAb (ATL-HPA034865) Datasheet (External Link) |
| Vendor Page | Anti ICOS pAb (ATL-HPA034865) at Atlas Antibodies |
| Documents & Links for Anti ICOS pAb (ATL-HPA034865) | |
| Datasheet | Anti ICOS pAb (ATL-HPA034865) Datasheet (External Link) |
| Vendor Page | Anti ICOS pAb (ATL-HPA034865) |