Anti ICE1 pAb (ATL-HPA061934)

Atlas Antibodies

SKU: ATL-HPA061934-25

• 

Protein Description: interactor of little elongation complex ELL subunit 1
Gene Name: ICE1
Alternative Gene Name: KIAA0947
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034525: 40%, ENSRNOG00000023053: 31%
Entrez Gene ID: 23379
Uniprot ID: Q9Y2F5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKGSGTWEEKPKSHEAIQALNTWEVNKVTTSGLETFTATLRESSATHSLVGEKHWTTASRSMSDRKRDILHETKTQMEVREMDKSVQTEKTIH
• Gene Sequence: NKGSGTWEEKPKSHEAIQALNTWEVNKVTTSGLETFTATLRESSATHSLVGEKHWTTASRSMSDRKRDILHETKTQMEVREMDKSVQTEKTIH
• Gene ID - Mouse: ENSMUSG00000034525
• Gene ID - Rat: ENSRNOG00000023053
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.