Anti ICAM3 pAb (ATL-HPA049820)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049820-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ICAM3
Alternative Gene Name: CD50, CDW50, ICAM-R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020712: 37%, ENSRNOG00000010929: 39%
Entrez Gene ID: 3385
Uniprot ID: P32942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQIT |
| Gene Sequence | AGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQIT |
| Gene ID - Mouse | ENSMUSG00000020712 |
| Gene ID - Rat | ENSRNOG00000010929 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ICAM3 pAb (ATL-HPA049820) | |
| Datasheet | Anti ICAM3 pAb (ATL-HPA049820) Datasheet (External Link) |
| Vendor Page | Anti ICAM3 pAb (ATL-HPA049820) at Atlas Antibodies |
| Documents & Links for Anti ICAM3 pAb (ATL-HPA049820) | |
| Datasheet | Anti ICAM3 pAb (ATL-HPA049820) Datasheet (External Link) |
| Vendor Page | Anti ICAM3 pAb (ATL-HPA049820) |