Anti ICA1 pAb (ATL-HPA061452)

Atlas Antibodies

Catalog No.:
ATL-HPA061452-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: islet cell autoantigen 1, 69kDa
Gene Name: ICA1
Alternative Gene Name: ICAp69
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062995: 70%, ENSRNOG00000008628: 77%
Entrez Gene ID: 3382
Uniprot ID: Q05084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HESFKGYQPYEFTTLKSLQDPMKKLVEKEEKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFK
Gene Sequence HESFKGYQPYEFTTLKSLQDPMKKLVEKEEKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFK
Gene ID - Mouse ENSMUSG00000062995
Gene ID - Rat ENSRNOG00000008628
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ICA1 pAb (ATL-HPA061452)
Datasheet Anti ICA1 pAb (ATL-HPA061452) Datasheet (External Link)
Vendor Page Anti ICA1 pAb (ATL-HPA061452) at Atlas Antibodies

Documents & Links for Anti ICA1 pAb (ATL-HPA061452)
Datasheet Anti ICA1 pAb (ATL-HPA061452) Datasheet (External Link)
Vendor Page Anti ICA1 pAb (ATL-HPA061452)