Anti ICA1 pAb (ATL-HPA017646)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017646-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/83761/152507/atl-hpa017646_anti-ica1-pab-atl-hpa017646_34136__51370.1681102478.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ICA1
Alternative Gene Name: ICAp69
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062995: 86%, ENSRNOG00000008628: 84%
Entrez Gene ID: 3382
Uniprot ID: Q05084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DELLDMKSEEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQTGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELL |
| Gene Sequence | DELLDMKSEEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQTGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELL |
| Gene ID - Mouse | ENSMUSG00000062995 |
| Gene ID - Rat | ENSRNOG00000008628 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ICA1 pAb (ATL-HPA017646) | |
| Datasheet | Anti ICA1 pAb (ATL-HPA017646) Datasheet (External Link) |
| Vendor Page | Anti ICA1 pAb (ATL-HPA017646) at Atlas Antibodies |
| Documents & Links for Anti ICA1 pAb (ATL-HPA017646) | |
| Datasheet | Anti ICA1 pAb (ATL-HPA017646) Datasheet (External Link) |
| Vendor Page | Anti ICA1 pAb (ATL-HPA017646) |
| Citations for Anti ICA1 pAb (ATL-HPA017646) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |