Anti IBA57 pAb (ATL-HPA030556)

Atlas Antibodies

Catalog No.:
ATL-HPA030556-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: IBA57 homolog, iron-sulfur cluster assembly
Gene Name: IBA57
Alternative Gene Name: C1orf69, FLJ12734
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049287: 70%, ENSRNOG00000022725: 70%
Entrez Gene ID: 200205
Uniprot ID: Q5T440
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGYAHFLNVQGRTLYDVILYGLQEHSEVSGFLLECDSSVQGALQKHLALYRIRRKVTVEPHPELRVWAVLPSSPEACGAASLQERAGAAAILIRD
Gene Sequence AGYAHFLNVQGRTLYDVILYGLQEHSEVSGFLLECDSSVQGALQKHLALYRIRRKVTVEPHPELRVWAVLPSSPEACGAASLQERAGAAAILIRD
Gene ID - Mouse ENSMUSG00000049287
Gene ID - Rat ENSRNOG00000022725
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IBA57 pAb (ATL-HPA030556)
Datasheet Anti IBA57 pAb (ATL-HPA030556) Datasheet (External Link)
Vendor Page Anti IBA57 pAb (ATL-HPA030556) at Atlas Antibodies

Documents & Links for Anti IBA57 pAb (ATL-HPA030556)
Datasheet Anti IBA57 pAb (ATL-HPA030556) Datasheet (External Link)
Vendor Page Anti IBA57 pAb (ATL-HPA030556)