Anti IBA57 pAb (ATL-HPA030555 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030555-100

Protein Description: IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae)
Gene Name: IBA57
Alternative Gene Name: C1orf69, FLJ12734
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049287: 67%, ENSRNOG00000022725: 65%
Entrez Gene ID: 200205
Uniprot ID: Q5T440
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FPVRFLDPLPTSGITPGATVLTASGQTVGKFRAGQGNVGLALLWSEKIKGPLHIRASEGAQVALAASVPDWWPTVSK
• Gene Sequence: FPVRFLDPLPTSGITPGATVLTASGQTVGKFRAGQGNVGLALLWSEKIKGPLHIRASEGAQVALAASVPDWWPTVSK
• Gene ID - Mouse: ENSMUSG00000049287
• Gene ID - Rat: ENSRNOG00000022725
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.