Anti IARS2 pAb (ATL-HPA024596 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024596-100

Protein Description: isoleucyl-tRNA synthetase 2, mitochondrial
Gene Name: IARS2
Alternative Gene Name: FLJ10326
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026618: 86%, ENSRNOG00000002368: 84%
Entrez Gene ID: 55699
Uniprot ID: Q9NSE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALNGMVEMMDRRPYWCISRQRVWGVPIPVFHHKTKDEYLINSQTTEHIVKLVEQHGSDIWWTLPPEQLLPKEVLSEVGGPDALEYVPGQD
• Gene Sequence: ALNGMVEMMDRRPYWCISRQRVWGVPIPVFHHKTKDEYLINSQTTEHIVKLVEQHGSDIWWTLPPEQLLPKEVLSEVGGPDALEYVPGQD
• Gene ID - Mouse: ENSMUSG00000026618
• Gene ID - Rat: ENSRNOG00000002368
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.