Anti IAPP pAb (ATL-HPA053194 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA053194-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: islet amyloid polypeptide
Gene Name: IAPP
Alternative Gene Name: AMYLIN, DAP, IAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041681: 63%, ENSRNOG00000012417: 63%
Entrez Gene ID: 3375
Uniprot ID: P10997
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLP
Gene Sequence LVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLP
Gene ID - Mouse ENSMUSG00000041681
Gene ID - Rat ENSRNOG00000012417
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IAPP pAb (ATL-HPA053194 w/enhanced validation)
Datasheet Anti IAPP pAb (ATL-HPA053194 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IAPP pAb (ATL-HPA053194 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti IAPP pAb (ATL-HPA053194 w/enhanced validation)
Datasheet Anti IAPP pAb (ATL-HPA053194 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IAPP pAb (ATL-HPA053194 w/enhanced validation)
Citations for Anti IAPP pAb (ATL-HPA053194 w/enhanced validation) – 3 Found
Kayatekin, Can; Amasino, Audra; Gaglia, Giorgio; Flannick, Jason; Bonner, Julia M; Fanning, Saranna; Narayan, Priyanka; Barrasa, M Inmaculada; Pincus, David; Landgraf, Dirk; Nelson, Justin; Hesse, William R; Costanzo, Michael; Myers, Chad L; Boone, Charles; Florez, Jose C; Lindquist, Susan. Translocon Declogger Ste24 Protects against IAPP Oligomer-Induced Proteotoxicity. Cell. 2018;173(1):62-73.e9.  PubMed
Rodriguez-Calvo, Teresa; Chen, Yi-Chun; Verchere, C Bruce; Haataja, Leena; Arvan, Peter; Leete, Pia; Richardson, Sarah J; Morgan, Noel G; Qian, Wei-Jun; Pugliese, Alberto; Atkinson, Mark; Evans-Molina, Carmella; Sims, Emily K. Altered β-Cell Prohormone Processing and Secretion in Type 1 Diabetes. Diabetes. 2021;70(5):1038-1050.  PubMed
Damond, Nicolas; Engler, Stefanie; Zanotelli, Vito R T; Schapiro, Denis; Wasserfall, Clive H; Kusmartseva, Irina; Nick, Harry S; Thorel, Fabrizio; Herrera, Pedro L; Atkinson, Mark A; Bodenmiller, Bernd. A Map of Human Type 1 Diabetes Progression by Imaging Mass Cytometry. Cell Metabolism. 2019;29(3):755-768.e5.  PubMed