Anti IAPP pAb (ATL-HPA053194 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053194-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: IAPP
Alternative Gene Name: AMYLIN, DAP, IAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041681: 63%, ENSRNOG00000012417: 63%
Entrez Gene ID: 3375
Uniprot ID: P10997
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLP |
| Gene Sequence | LVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLP |
| Gene ID - Mouse | ENSMUSG00000041681 |
| Gene ID - Rat | ENSRNOG00000012417 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IAPP pAb (ATL-HPA053194 w/enhanced validation) | |
| Datasheet | Anti IAPP pAb (ATL-HPA053194 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IAPP pAb (ATL-HPA053194 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti IAPP pAb (ATL-HPA053194 w/enhanced validation) | |
| Datasheet | Anti IAPP pAb (ATL-HPA053194 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IAPP pAb (ATL-HPA053194 w/enhanced validation) |
| Citations for Anti IAPP pAb (ATL-HPA053194 w/enhanced validation) – 3 Found |
| Kayatekin, Can; Amasino, Audra; Gaglia, Giorgio; Flannick, Jason; Bonner, Julia M; Fanning, Saranna; Narayan, Priyanka; Barrasa, M Inmaculada; Pincus, David; Landgraf, Dirk; Nelson, Justin; Hesse, William R; Costanzo, Michael; Myers, Chad L; Boone, Charles; Florez, Jose C; Lindquist, Susan. Translocon Declogger Ste24 Protects against IAPP Oligomer-Induced Proteotoxicity. Cell. 2018;173(1):62-73.e9. PubMed |
| Rodriguez-Calvo, Teresa; Chen, Yi-Chun; Verchere, C Bruce; Haataja, Leena; Arvan, Peter; Leete, Pia; Richardson, Sarah J; Morgan, Noel G; Qian, Wei-Jun; Pugliese, Alberto; Atkinson, Mark; Evans-Molina, Carmella; Sims, Emily K. Altered β-Cell Prohormone Processing and Secretion in Type 1 Diabetes. Diabetes. 2021;70(5):1038-1050. PubMed |
| Damond, Nicolas; Engler, Stefanie; Zanotelli, Vito R T; Schapiro, Denis; Wasserfall, Clive H; Kusmartseva, Irina; Nick, Harry S; Thorel, Fabrizio; Herrera, Pedro L; Atkinson, Mark A; Bodenmiller, Bernd. A Map of Human Type 1 Diabetes Progression by Imaging Mass Cytometry. Cell Metabolism. 2019;29(3):755-768.e5. PubMed |