Anti IAH1 pAb (ATL-HPA076040)

Atlas Antibodies

Catalog No.:
ATL-HPA076040-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: isoamyl acetate hydrolyzing esterase 1 (putative)
Gene Name: IAH1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062054: 70%, ENSRNOG00000060853: 74%
Entrez Gene ID: 285148
Uniprot ID: Q2TAA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQHIPLEEYAANLKSMVQYLKSVDIPENRVILITPTPLCETAWEEQCIIQGCKL
Gene Sequence KQHIPLEEYAANLKSMVQYLKSVDIPENRVILITPTPLCETAWEEQCIIQGCKL
Gene ID - Mouse ENSMUSG00000062054
Gene ID - Rat ENSRNOG00000060853
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IAH1 pAb (ATL-HPA076040)
Datasheet Anti IAH1 pAb (ATL-HPA076040) Datasheet (External Link)
Vendor Page Anti IAH1 pAb (ATL-HPA076040) at Atlas Antibodies

Documents & Links for Anti IAH1 pAb (ATL-HPA076040)
Datasheet Anti IAH1 pAb (ATL-HPA076040) Datasheet (External Link)
Vendor Page Anti IAH1 pAb (ATL-HPA076040)