Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067155-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HYDIN
Alternative Gene Name: CILD5, DKFZp434D0513, KIAA1864, PPP1R31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059854: 69%, ENSRNOG00000017178: 71%
Entrez Gene ID: 54768
Uniprot ID: Q4G0P3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YLPGVPEVFKRSFQIQIAHLDPENITLSGEGIFPQICLDLPRNLTANEKYEMFLNQARKNTDKEYNKCEMLDHFDVITEEVPEDEPAEVSAHLQ |
| Gene Sequence | YLPGVPEVFKRSFQIQIAHLDPENITLSGEGIFPQICLDLPRNLTANEKYEMFLNQARKNTDKEYNKCEMLDHFDVITEEVPEDEPAEVSAHLQ |
| Gene ID - Mouse | ENSMUSG00000059854 |
| Gene ID - Rat | ENSRNOG00000017178 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation) | |
| Datasheet | Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation) | |
| Datasheet | Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation) |
| Citations for Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation) – 2 Found |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |
| Yu, Hui; Shi, Xiao; Shao, Zhongmei; Geng, Hao; Guo, Senzhao; Li, Kuokuo; Gu, Meng; Xu, Chuan; Gao, Yang; Tan, Qing; Duan, Zongliu; Wu, Huan; Hua, Rong; Guo, Rui; Wei, Zhaolian; Zhou, Ping; Cao, Yunxia; He, Xiaojin; Li, Liang; Zhang, Xiaoping; Lv, Mingrong. Novel HYDIN variants associated with male infertility in two Chinese families. Frontiers In Endocrinology. 14( 36742411):1118841. PubMed |