Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA067155-25
  • Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-HYDIN antibody. Corresponding HYDIN RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: HYDIN, axonemal central pair apparatus protein
Gene Name: HYDIN
Alternative Gene Name: CILD5, DKFZp434D0513, KIAA1864, PPP1R31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059854: 69%, ENSRNOG00000017178: 71%
Entrez Gene ID: 54768
Uniprot ID: Q4G0P3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLPGVPEVFKRSFQIQIAHLDPENITLSGEGIFPQICLDLPRNLTANEKYEMFLNQARKNTDKEYNKCEMLDHFDVITEEVPEDEPAEVSAHLQ
Gene Sequence YLPGVPEVFKRSFQIQIAHLDPENITLSGEGIFPQICLDLPRNLTANEKYEMFLNQARKNTDKEYNKCEMLDHFDVITEEVPEDEPAEVSAHLQ
Gene ID - Mouse ENSMUSG00000059854
Gene ID - Rat ENSRNOG00000017178
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation)
Datasheet Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation)
Datasheet Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation)



Citations for Anti HYDIN pAb (ATL-HPA067155 w/enhanced validation) – 2 Found
Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)  PubMed
Yu, Hui; Shi, Xiao; Shao, Zhongmei; Geng, Hao; Guo, Senzhao; Li, Kuokuo; Gu, Meng; Xu, Chuan; Gao, Yang; Tan, Qing; Duan, Zongliu; Wu, Huan; Hua, Rong; Guo, Rui; Wei, Zhaolian; Zhou, Ping; Cao, Yunxia; He, Xiaojin; Li, Liang; Zhang, Xiaoping; Lv, Mingrong. Novel HYDIN variants associated with male infertility in two Chinese families. Frontiers In Endocrinology. 14( 36742411):1118841.  PubMed