Anti HYAL3 pAb (ATL-HPA049402)

Atlas Antibodies

Catalog No.:
ATL-HPA049402-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: hyaluronoglucosaminidase 3
Gene Name: HYAL3
Alternative Gene Name: LUCA-3, LUCA14, Minna14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036091: 71%, ENSRNOG00000016093: 77%
Entrez Gene ID: 8372
Uniprot ID: O43820
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALR
Gene Sequence AAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALR
Gene ID - Mouse ENSMUSG00000036091
Gene ID - Rat ENSRNOG00000016093
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HYAL3 pAb (ATL-HPA049402)
Datasheet Anti HYAL3 pAb (ATL-HPA049402) Datasheet (External Link)
Vendor Page Anti HYAL3 pAb (ATL-HPA049402) at Atlas Antibodies

Documents & Links for Anti HYAL3 pAb (ATL-HPA049402)
Datasheet Anti HYAL3 pAb (ATL-HPA049402) Datasheet (External Link)
Vendor Page Anti HYAL3 pAb (ATL-HPA049402)