Anti HYAL1 pAb (ATL-HPA002112 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002112-25

Protein Description: hyaluronoglucosaminidase 1
Gene Name: HYAL1
Alternative Gene Name: FUS2, HYAL-1, LUCA1, NAT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010051: 72%, ENSRNOG00000015858: 73%
Entrez Gene ID: 3373
Uniprot ID: Q12794
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHF
• Gene Sequence: SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHF
• Gene ID - Mouse: ENSMUSG00000010051
• Gene ID - Rat: ENSRNOG00000015858
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HYAL1 pAb (ATL-HPA002112 w/enhanced validation) – 3 Found

Siiskonen, Hanna; Poukka, Mari; Tyynelä-Korhonen, Kristiina; Sironen, Reijo; Pasonen-Seppänen, Sanna. Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma. Bmc Cancer. 2013;13( 23560496):181. 

Rizzardi, Anthony E; Rosener, Nikolaus K; Koopmeiners, Joseph S; Isaksson Vogel, Rachel; Metzger, Gregory J; Forster, Colleen L; Marston, Lauren O; Tiffany, Jessica R; McCarthy, James B; Turley, Eva A; Warlick, Christopher A; Henriksen, Jonathan C; Schmechel, Stephen C. Evaluation of protein biomarkers of prostate cancer aggressiveness. Bmc Cancer. 2014;14( 24708576):244. 

Knudtson, Jennifer F; McLaughlin, Jessica E; Santos, Marlen Tellez; Binkley, Peter A; Tekmal, Rajeshwar R; Schenken, Robert S. The Hyaluronic Acid System is Intact in Menstrual Endometrial Cells in Women With and Without Endometriosis. Reproductive Sciences (Thousand Oaks, Calif.). 2019;26(1):109-113.