Anti HTRA3 pAb (ATL-HPA063810)

Atlas Antibodies

Catalog No.:
ATL-HPA063810-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: HtrA serine peptidase 3
Gene Name: HTRA3
Alternative Gene Name: Prsp, Tasp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029096: 89%, ENSRNOG00000008182: 85%
Entrez Gene ID: 94031
Uniprot ID: P83110
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKKKLPVL
Gene Sequence NAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKKKLPVL
Gene ID - Mouse ENSMUSG00000029096
Gene ID - Rat ENSRNOG00000008182
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HTRA3 pAb (ATL-HPA063810)
Datasheet Anti HTRA3 pAb (ATL-HPA063810) Datasheet (External Link)
Vendor Page Anti HTRA3 pAb (ATL-HPA063810) at Atlas Antibodies

Documents & Links for Anti HTRA3 pAb (ATL-HPA063810)
Datasheet Anti HTRA3 pAb (ATL-HPA063810) Datasheet (External Link)
Vendor Page Anti HTRA3 pAb (ATL-HPA063810)