Anti HTR7 pAb (ATL-HPA073617)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073617-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HTR7
Alternative Gene Name: 5-HT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024798: 61%, ENSRNOG00000055705: 59%
Entrez Gene ID: 3363
Uniprot ID: P34969
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHN |
| Gene Sequence | NRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHN |
| Gene ID - Mouse | ENSMUSG00000024798 |
| Gene ID - Rat | ENSRNOG00000055705 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HTR7 pAb (ATL-HPA073617) | |
| Datasheet | Anti HTR7 pAb (ATL-HPA073617) Datasheet (External Link) |
| Vendor Page | Anti HTR7 pAb (ATL-HPA073617) at Atlas Antibodies |
| Documents & Links for Anti HTR7 pAb (ATL-HPA073617) | |
| Datasheet | Anti HTR7 pAb (ATL-HPA073617) Datasheet (External Link) |
| Vendor Page | Anti HTR7 pAb (ATL-HPA073617) |