Anti HTR7 pAb (ATL-HPA073617)

Atlas Antibodies

Catalog No.:
ATL-HPA073617-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: 5-hydroxytryptamine receptor 7
Gene Name: HTR7
Alternative Gene Name: 5-HT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024798: 61%, ENSRNOG00000055705: 59%
Entrez Gene ID: 3363
Uniprot ID: P34969
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHN
Gene Sequence NRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHN
Gene ID - Mouse ENSMUSG00000024798
Gene ID - Rat ENSRNOG00000055705
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HTR7 pAb (ATL-HPA073617)
Datasheet Anti HTR7 pAb (ATL-HPA073617) Datasheet (External Link)
Vendor Page Anti HTR7 pAb (ATL-HPA073617) at Atlas Antibodies

Documents & Links for Anti HTR7 pAb (ATL-HPA073617)
Datasheet Anti HTR7 pAb (ATL-HPA073617) Datasheet (External Link)
Vendor Page Anti HTR7 pAb (ATL-HPA073617)