Anti HTR3E pAb (ATL-HPA049764)

Atlas Antibodies

Catalog No.:
ATL-HPA049764-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: 5-hydroxytryptamine (serotonin) receptor 3E, ionotropic
Gene Name: HTR3E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031796: 33%, ENSRNOG00000026944: 27%
Entrez Gene ID: 285242
Uniprot ID: A5X5Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAFILSRATPRPALGPLSYREHRVALLHLTHSMSTTGRGVTFTINCSGF
Gene Sequence LAFILSRATPRPALGPLSYREHRVALLHLTHSMSTTGRGVTFTINCSGF
Gene ID - Mouse ENSMUSG00000031796
Gene ID - Rat ENSRNOG00000026944
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HTR3E pAb (ATL-HPA049764)
Datasheet Anti HTR3E pAb (ATL-HPA049764) Datasheet (External Link)
Vendor Page Anti HTR3E pAb (ATL-HPA049764) at Atlas Antibodies

Documents & Links for Anti HTR3E pAb (ATL-HPA049764)
Datasheet Anti HTR3E pAb (ATL-HPA049764) Datasheet (External Link)
Vendor Page Anti HTR3E pAb (ATL-HPA049764)