Anti HTR3A pAb (ATL-HPA069442)

Atlas Antibodies

Catalog No.: ATL-HPA069442-25

Protein Description: 5-hydroxytryptamine receptor 3A
Gene Name: HTR3A
Alternative Gene Name: 5-HT3A, 5-HT3R, HTR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032269: 81%, ENSRNOG00000006595: 78%
Entrez Gene ID: 3359
Uniprot ID: P46098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEI
• Gene Sequence: LRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEI
• Gene ID - Mouse: ENSMUSG00000032269
• Gene ID - Rat: ENSRNOG00000006595
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.