Anti HTR1F pAb (ATL-HPA005555)

Atlas Antibodies

Catalog No.: ATL-HPA005555-25

Protein Description: 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled
Gene Name: HTR1F
Alternative Gene Name: 5-HT1F, HTR1EL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050783: 83%, ENSRNOG00000000716: 84%
Entrez Gene ID: 3355
Uniprot ID: P30939
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKS
• Gene Sequence: AKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKS
• Gene ID - Mouse: ENSMUSG00000050783
• Gene ID - Rat: ENSRNOG00000000716
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HTR1F pAb (ATL-HPA005555) – 1 Found

Korchynska, Solomiia; Krassnitzer, Maria; Malenczyk, Katarzyna; Prasad, Rashmi B; Tretiakov, Evgenii O; Rehman, Sabah; Cinquina, Valentina; Gernedl, Victoria; Farlik, Matthias; Petersen, Julian; Hannes, Sophia; Schachenhofer, Julia; Reisinger, Sonali N; Zambon, Alice; Asplund, Olof; Artner, Isabella; Keimpema, Erik; Lubec, Gert; Mulder, Jan; Bock, Christoph; Pollak, Daniela D; Romanov, Roman A; Pifl, Christian; Groop, Leif; Hökfelt, Tomas Gm; Harkany, Tibor. Life-long impairment of glucose homeostasis upon prenatal exposure to psychostimulants. The Embo Journal. 2020;39(1):e100882.