Anti HSPH1 pAb (ATL-HPA028675 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028675-25

Protein Description: heat shock 105kDa/110kDa protein 1
Gene Name: HSPH1
Alternative Gene Name: HSP105A, HSP105B, KIAA0201, NY-CO-25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029657: 94%, ENSRNOG00000000902: 97%
Entrez Gene ID: 10808
Uniprot ID: Q92598
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLG
• Gene Sequence: TQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLG
• Gene ID - Mouse: ENSMUSG00000029657
• Gene ID - Rat: ENSRNOG00000000902
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HSPH1 pAb (ATL-HPA028675 w/enhanced validation) – 1 Found

Babu, Niraj; Mohan, Sonali; Nanjappa, Vishalakshi; Chavan, Sandip; Advani, Jayshree; Khan, Aafaque Ahmed; Renuse, Santosh; Radhakrishnan, Aneesha; Prasad, T S Keshava; Kumar, Rekha V; Ray, Jay Gopal; Biswas, Manjusha; Thiyagarajan, Saravanan; Califano, Joseph A; Sidransky, David; Gowda, Harsha; Chatterjee, Aditi. Identification of potential biomarkers of head and neck squamous cell carcinoma using iTRAQ based quantitative proteomic approach. Data In Brief. 2018;19( 30225281):1124-1130.