Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA071444-25
  • Immunohistochemistry analysis in human testis and pancreas tissues using Anti-HSPBP1 antibody. Corresponding HSPBP1 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1
Gene Name: HSPBP1
Alternative Gene Name: FES1, HspBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063802: 99%, ENSRNOG00000017795: 100%
Entrez Gene ID: 23640
Uniprot ID: Q9NZL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT
Gene Sequence KLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT
Gene ID - Mouse ENSMUSG00000063802
Gene ID - Rat ENSRNOG00000017795
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation)
Datasheet Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation)