Anti HSPBP1 pAb (ATL-HPA070398)

Atlas Antibodies

SKU:
ATL-HPA070398-100
  • Immunofluorescent staining of human cell line A549 shows localization to cytosol & centrosome.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: HSPA (Hsp70) binding protein 1
Gene Name: HSPBP1
Alternative Gene Name: FES1, HspBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063802: 100%, ENSRNOG00000017795: 100%
Entrez Gene ID: 23640
Uniprot ID: Q9NZL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVL
Gene Sequence LELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVL
Gene ID - Mouse ENSMUSG00000063802
Gene ID - Rat ENSRNOG00000017795
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HSPBP1 pAb (ATL-HPA070398)
Datasheet Anti HSPBP1 pAb (ATL-HPA070398) Datasheet (External Link)
Vendor Page Anti HSPBP1 pAb (ATL-HPA070398) at Atlas Antibodies

Documents & Links for Anti HSPBP1 pAb (ATL-HPA070398)
Datasheet Anti HSPBP1 pAb (ATL-HPA070398) Datasheet (External Link)
Vendor Page Anti HSPBP1 pAb (ATL-HPA070398)