Anti HSPB7 pAb (ATL-HPA027639 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027639-100

Protein Description: heat shock 27kDa protein family, member 7 (cardiovascular)
Gene Name: HSPB7
Alternative Gene Name: cvHSP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006221: 99%, ENSRNOG00000029079: 100%
Entrez Gene ID: 27129
Uniprot ID: Q9UBY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIK
• Gene Sequence: SPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIK
• Gene ID - Mouse: ENSMUSG00000006221
• Gene ID - Rat: ENSRNOG00000029079
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.