Anti HSPA5 pAb (ATL-HPA038845 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038845-25

Protein Description: heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)
Gene Name: HSPA5
Alternative Gene Name: BiP, GRP78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026864: 100%, ENSRNOG00000018294: 99%
Entrez Gene ID: 3309
Uniprot ID: P11021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKL
• Gene Sequence: EKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKL
• Gene ID - Mouse: ENSMUSG00000026864
• Gene ID - Rat: ENSRNOG00000018294
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HSPA5 pAb (ATL-HPA038845 w/enhanced validation) – 3 Found

Unger, Andreas; Beckendorf, Lisa; Böhme, Pierre; Kley, Rudolf; von Frieling-Salewsky, Marion; Lochmüller, Hanns; Schröder, Rolf; Fürst, Dieter O; Vorgerd, Matthias; Linke, Wolfgang A. Translocation of molecular chaperones to the titin springs is common in skeletal myopathy patients and affects sarcomere function. Acta Neuropathologica Communications. 2017;5(1):72. 

Mennerich, Daniela; Kubaichuk, Kateryna; Raza, Ghulam S; Fuhrmann, Dominik C; Herzig, Karl-Heinz; Brüne, Bernhard; Kietzmann, Thomas. ER-stress promotes VHL-independent degradation of hypoxia-inducible factors via FBXW1A/βTrCP. Redox Biology. 2022;50( 35074541):102243. 

Aguiar, Jennifer A; Tremblay, Benjamin J-M; Mansfield, Michael J; Woody, Owen; Lobb, Briallen; Banerjee, Arinjay; Chandiramohan, Abiram; Tiessen, Nicholas; Cao, Quynh; Dvorkin-Gheva, Anna; Revill, Spencer; Miller, Matthew S; Carlsten, Christopher; Organ, Louise; Joseph, Chitra; John, Alison; Hanson, Paul; Austin, Richard C; McManus, Bruce M; Jenkins, Gisli; Mossman, Karen; Ask, Kjetil; Doxey, Andrew C; Hirota, Jeremy A. Gene expression and in situ protein profiling of candidate SARS-CoV-2 receptors in human airway epithelial cells and lung tissue. The European Respiratory Journal. 2020;56(3)