Anti HSDL2 pAb (ATL-HPA050453 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA050453-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: hydroxysteroid dehydrogenase like 2
Gene Name: HSDL2
Alternative Gene Name: C9orf99, SDR13C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028383: 88%, ENSRNOG00000016692: 88%
Entrez Gene ID: 84263
Uniprot ID: Q6YN16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFL
Gene Sequence AKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFL
Gene ID - Mouse ENSMUSG00000028383
Gene ID - Rat ENSRNOG00000016692
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HSDL2 pAb (ATL-HPA050453 w/enhanced validation)
Datasheet Anti HSDL2 pAb (ATL-HPA050453 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HSDL2 pAb (ATL-HPA050453 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HSDL2 pAb (ATL-HPA050453 w/enhanced validation)
Datasheet Anti HSDL2 pAb (ATL-HPA050453 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HSDL2 pAb (ATL-HPA050453 w/enhanced validation)
Citations for Anti HSDL2 pAb (ATL-HPA050453 w/enhanced validation) – 3 Found
Zhang, Deng-Yong; Liu, Zhong; Lu, Zheng; Sun, Wan-Liang; Ma, Xiang; Zhang, Pei; Wu, Bin-Quan; Cui, Pei-Yuan. Lentivirus-mediated overexpression of HSDL2 suppresses cell proliferation and induces apoptosis in cholangiocarcinoma. Oncotargets And Therapy. 11( 30410369):7133-7142.  PubMed
Sun, Qing; Zhang, Yilin; Su, Juanjuan; Li, Tiechen; Jiang, Yuxin. Role of Hydroxysteroid Dehydrogenase-Like 2 (HSDL2) in Human Ovarian Cancer. Medical Science Monitor : International Medical Journal Of Experimental And Clinical Research. 2018;24( 29894468):3997-4008.  PubMed
Soler, Laura; Alves, Sabine; Brionne, Aurélien; Jacques, Aurore; Guérin, Vanessa; Cherif-Feildel, Maeva; Combes-Soia, Lucie; Fouchécourt, Sophie; Thélie, Aurore; Blesbois, Elisabeth; McGrew, Michael J; Labas, Valérie; Govoroun, Marina S. Protein expression reveals a molecular sexual identity of avian primordial germ cells at pre-gonadal stages. Scientific Reports. 2021;11(1):19236.  PubMed