Anti HSD3B7 pAb (ATL-HPA060847)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060847-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: HSD3B7
Alternative Gene Name: C(27)-3BETA-HSD, SDR11E3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042289: 84%, ENSRNOG00000019080: 84%
Entrez Gene ID: 80270
Uniprot ID: Q9H2F3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVLYAPLLNPYTLAVANTTFTVSTDKAQRHFGYEPLFSWEDSRTRTILWVQAATGSAQ |
| Gene Sequence | LVLYAPLLNPYTLAVANTTFTVSTDKAQRHFGYEPLFSWEDSRTRTILWVQAATGSAQ |
| Gene ID - Mouse | ENSMUSG00000042289 |
| Gene ID - Rat | ENSRNOG00000019080 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HSD3B7 pAb (ATL-HPA060847) | |
| Datasheet | Anti HSD3B7 pAb (ATL-HPA060847) Datasheet (External Link) |
| Vendor Page | Anti HSD3B7 pAb (ATL-HPA060847) at Atlas Antibodies |
| Documents & Links for Anti HSD3B7 pAb (ATL-HPA060847) | |
| Datasheet | Anti HSD3B7 pAb (ATL-HPA060847) Datasheet (External Link) |
| Vendor Page | Anti HSD3B7 pAb (ATL-HPA060847) |