Anti HSD3B7 pAb (ATL-HPA060847)

Atlas Antibodies

SKU:
ATL-HPA060847-25
  • Immunofluorescent staining of human cell line Hep G2 shows localization to lipid droplets.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7
Gene Name: HSD3B7
Alternative Gene Name: C(27)-3BETA-HSD, SDR11E3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042289: 84%, ENSRNOG00000019080: 84%
Entrez Gene ID: 80270
Uniprot ID: Q9H2F3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVLYAPLLNPYTLAVANTTFTVSTDKAQRHFGYEPLFSWEDSRTRTILWVQAATGSAQ
Gene Sequence LVLYAPLLNPYTLAVANTTFTVSTDKAQRHFGYEPLFSWEDSRTRTILWVQAATGSAQ
Gene ID - Mouse ENSMUSG00000042289
Gene ID - Rat ENSRNOG00000019080
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HSD3B7 pAb (ATL-HPA060847)
Datasheet Anti HSD3B7 pAb (ATL-HPA060847) Datasheet (External Link)
Vendor Page Anti HSD3B7 pAb (ATL-HPA060847) at Atlas Antibodies

Documents & Links for Anti HSD3B7 pAb (ATL-HPA060847)
Datasheet Anti HSD3B7 pAb (ATL-HPA060847) Datasheet (External Link)
Vendor Page Anti HSD3B7 pAb (ATL-HPA060847)