Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA065296-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hydroxysteroid (17-beta) dehydrogenase 1
Gene Name: HSD17B1
Alternative Gene Name: EDH17B2, EDHB17, HSD17, MGC138140, SDR28C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019301: 74%, ENSRNOG00000019830: 77%
Entrez Gene ID: 3292
Uniprot ID: P14061
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALDPSQSFKVYATLRDLKTQGRLWEAARALACPQG
Gene Sequence ALDPSQSFKVYATLRDLKTQGRLWEAARALACPQG
Gene ID - Mouse ENSMUSG00000019301
Gene ID - Rat ENSRNOG00000019830
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation)
Datasheet Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation)
Datasheet Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation)