Anti HSD11B2 pAb (ATL-HPA056385 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA056385-25
  • Immunohistochemistry analysis in human kidney and liver tissues using Anti-HSD11B2 antibody. Corresponding HSD11B2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line RT4 shows localization to vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hydroxysteroid (11-beta) dehydrogenase 2
Gene Name: HSD11B2
Alternative Gene Name: SDR9C3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031891: 66%, ENSRNOG00000017084: 76%
Entrez Gene ID: 3291
Uniprot ID: P80365
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPG
Gene Sequence SDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPG
Gene ID - Mouse ENSMUSG00000031891
Gene ID - Rat ENSRNOG00000017084
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti HSD11B2 pAb (ATL-HPA056385 w/enhanced validation)
Datasheet Anti HSD11B2 pAb (ATL-HPA056385 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HSD11B2 pAb (ATL-HPA056385 w/enhanced validation)