Anti HSBP1L1 pAb (ATL-HPA048273)

Atlas Antibodies

Catalog No.:
ATL-HPA048273-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: heat shock factor binding protein 1-like 1
Gene Name: HSBP1L1
Alternative Gene Name: FLJ10967, MGC189743
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078963: 76%, ENSRNOG00000059055: 81%
Entrez Gene ID: 440498
Uniprot ID: C9JCN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLFQELQEHFQALTATLNLRMEEMGNRIEDLQKNVNDLMVQAGIENSIKEQMLE
Gene Sequence NLFQELQEHFQALTATLNLRMEEMGNRIEDLQKNVNDLMVQAGIENSIKEQMLE
Gene ID - Mouse ENSMUSG00000078963
Gene ID - Rat ENSRNOG00000059055
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HSBP1L1 pAb (ATL-HPA048273)
Datasheet Anti HSBP1L1 pAb (ATL-HPA048273) Datasheet (External Link)
Vendor Page Anti HSBP1L1 pAb (ATL-HPA048273) at Atlas Antibodies

Documents & Links for Anti HSBP1L1 pAb (ATL-HPA048273)
Datasheet Anti HSBP1L1 pAb (ATL-HPA048273) Datasheet (External Link)
Vendor Page Anti HSBP1L1 pAb (ATL-HPA048273)