Anti HS3ST3A1 pAb (ATL-HPA062518)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062518-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HS3ST3A1
Alternative Gene Name: 30ST3A1, 3OST3A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047759: 57%, ENSRNOG00000024591: 50%
Entrez Gene ID: 9955
Uniprot ID: Q9Y663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES |
Gene Sequence | RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES |
Gene ID - Mouse | ENSMUSG00000047759 |
Gene ID - Rat | ENSRNOG00000024591 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HS3ST3A1 pAb (ATL-HPA062518) | |
Datasheet | Anti HS3ST3A1 pAb (ATL-HPA062518) Datasheet (External Link) |
Vendor Page | Anti HS3ST3A1 pAb (ATL-HPA062518) at Atlas Antibodies |
Documents & Links for Anti HS3ST3A1 pAb (ATL-HPA062518) | |
Datasheet | Anti HS3ST3A1 pAb (ATL-HPA062518) Datasheet (External Link) |
Vendor Page | Anti HS3ST3A1 pAb (ATL-HPA062518) |