Anti HS3ST3A1 pAb (ATL-HPA062518)

Atlas Antibodies

Catalog No.:
ATL-HPA062518-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1
Gene Name: HS3ST3A1
Alternative Gene Name: 30ST3A1, 3OST3A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047759: 57%, ENSRNOG00000024591: 50%
Entrez Gene ID: 9955
Uniprot ID: Q9Y663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES
Gene Sequence RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES
Gene ID - Mouse ENSMUSG00000047759
Gene ID - Rat ENSRNOG00000024591
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HS3ST3A1 pAb (ATL-HPA062518)
Datasheet Anti HS3ST3A1 pAb (ATL-HPA062518) Datasheet (External Link)
Vendor Page Anti HS3ST3A1 pAb (ATL-HPA062518) at Atlas Antibodies

Documents & Links for Anti HS3ST3A1 pAb (ATL-HPA062518)
Datasheet Anti HS3ST3A1 pAb (ATL-HPA062518) Datasheet (External Link)
Vendor Page Anti HS3ST3A1 pAb (ATL-HPA062518)