Anti HS3ST1 pAb (ATL-HPA002237 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002237-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: HS3ST1
Alternative Gene Name: 3OST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051022: 91%, ENSRNOG00000010598: 92%
Entrez Gene ID: 9957
Uniprot ID: O14792
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGR |
| Gene Sequence | TQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGR |
| Gene ID - Mouse | ENSMUSG00000051022 |
| Gene ID - Rat | ENSRNOG00000010598 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HS3ST1 pAb (ATL-HPA002237 w/enhanced validation) | |
| Datasheet | Anti HS3ST1 pAb (ATL-HPA002237 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HS3ST1 pAb (ATL-HPA002237 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HS3ST1 pAb (ATL-HPA002237 w/enhanced validation) | |
| Datasheet | Anti HS3ST1 pAb (ATL-HPA002237 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HS3ST1 pAb (ATL-HPA002237 w/enhanced validation) |