Anti HRCT1 pAb (ATL-HPA067038)

Atlas Antibodies

SKU:
ATL-HPA067038-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: histidine rich carboxyl terminus 1
Gene Name: HRCT1
Alternative Gene Name: LGLL338, PRO537, UNQ338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071001: 43%, ENSRNOG00000047935: 30%
Entrez Gene ID: 646962
Uniprot ID: Q6UXD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDCDVERNRTAAGGNRVRRAQPWPFRRRGHLGIFHHHR
Gene Sequence QDCDVERNRTAAGGNRVRRAQPWPFRRRGHLGIFHHHR
Gene ID - Mouse ENSMUSG00000071001
Gene ID - Rat ENSRNOG00000047935
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HRCT1 pAb (ATL-HPA067038)
Datasheet Anti HRCT1 pAb (ATL-HPA067038) Datasheet (External Link)
Vendor Page Anti HRCT1 pAb (ATL-HPA067038) at Atlas Antibodies

Documents & Links for Anti HRCT1 pAb (ATL-HPA067038)
Datasheet Anti HRCT1 pAb (ATL-HPA067038) Datasheet (External Link)
Vendor Page Anti HRCT1 pAb (ATL-HPA067038)