Anti HRCT1 pAb (ATL-HPA067038)

Atlas Antibodies

SKU: ATL-HPA067038-25

• 

Protein Description: histidine rich carboxyl terminus 1
Gene Name: HRCT1
Alternative Gene Name: LGLL338, PRO537, UNQ338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071001: 43%, ENSRNOG00000047935: 30%
Entrez Gene ID: 646962
Uniprot ID: Q6UXD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDCDVERNRTAAGGNRVRRAQPWPFRRRGHLGIFHHHR
• Gene Sequence: QDCDVERNRTAAGGNRVRRAQPWPFRRRGHLGIFHHHR
• Gene ID - Mouse: ENSMUSG00000071001
• Gene ID - Rat: ENSRNOG00000047935
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.