Anti HRASLS pAb (ATL-HPA051179)

Atlas Antibodies

Catalog No.:
ATL-HPA051179-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: HRAS-like suppressor
Gene Name: HRASLS
Alternative Gene Name: H-REV107, HRASLS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022525: 89%, ENSRNOG00000001711: 89%
Entrez Gene ID: 57110
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGYVINIAPVDGIPASFTSAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNN
Gene Sequence DGYVINIAPVDGIPASFTSAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNN
Gene ID - Mouse ENSMUSG00000022525
Gene ID - Rat ENSRNOG00000001711
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HRASLS pAb (ATL-HPA051179)
Datasheet Anti HRASLS pAb (ATL-HPA051179) Datasheet (External Link)
Vendor Page Anti HRASLS pAb (ATL-HPA051179) at Atlas Antibodies

Documents & Links for Anti HRASLS pAb (ATL-HPA051179)
Datasheet Anti HRASLS pAb (ATL-HPA051179) Datasheet (External Link)
Vendor Page Anti HRASLS pAb (ATL-HPA051179)