Anti HRAS pAb (ATL-HPA070222)
Atlas Antibodies
- SKU:
- ATL-HPA070222-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: HRAS
Alternative Gene Name: HRAS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025499: 100%, ENSRNOG00000016611: 100%
Entrez Gene ID: 3265
Uniprot ID: P01112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VREIRQHKLRKLNPPDESGPGCMSCKCVLS |
Gene Sequence | VREIRQHKLRKLNPPDESGPGCMSCKCVLS |
Gene ID - Mouse | ENSMUSG00000025499 |
Gene ID - Rat | ENSRNOG00000016611 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HRAS pAb (ATL-HPA070222) | |
Datasheet | Anti HRAS pAb (ATL-HPA070222) Datasheet (External Link) |
Vendor Page | Anti HRAS pAb (ATL-HPA070222) at Atlas Antibodies |
Documents & Links for Anti HRAS pAb (ATL-HPA070222) | |
Datasheet | Anti HRAS pAb (ATL-HPA070222) Datasheet (External Link) |
Vendor Page | Anti HRAS pAb (ATL-HPA070222) |