Anti HRAS pAb (ATL-HPA070222)

Atlas Antibodies

Catalog No.:
ATL-HPA070222-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: HRas proto-oncogene, GTPase
Gene Name: HRAS
Alternative Gene Name: HRAS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025499: 100%, ENSRNOG00000016611: 100%
Entrez Gene ID: 3265
Uniprot ID: P01112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VREIRQHKLRKLNPPDESGPGCMSCKCVLS
Gene Sequence VREIRQHKLRKLNPPDESGPGCMSCKCVLS
Gene ID - Mouse ENSMUSG00000025499
Gene ID - Rat ENSRNOG00000016611
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HRAS pAb (ATL-HPA070222)
Datasheet Anti HRAS pAb (ATL-HPA070222) Datasheet (External Link)
Vendor Page Anti HRAS pAb (ATL-HPA070222) at Atlas Antibodies

Documents & Links for Anti HRAS pAb (ATL-HPA070222)
Datasheet Anti HRAS pAb (ATL-HPA070222) Datasheet (External Link)
Vendor Page Anti HRAS pAb (ATL-HPA070222)