Anti HPSE2 pAb (ATL-HPA044603)

Atlas Antibodies

SKU:
ATL-HPA044603-25
  • Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: heparanase 2 (inactive)
Gene Name: HPSE2
Alternative Gene Name: HPA2, HPR2, UFS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074852: 96%, ENSRNOG00000011852: 25%
Entrez Gene ID: 60495
Uniprot ID: Q8WWQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKQQFSNTY
Gene Sequence GKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKQQFSNTY
Gene ID - Mouse ENSMUSG00000074852
Gene ID - Rat ENSRNOG00000011852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HPSE2 pAb (ATL-HPA044603)
Datasheet Anti HPSE2 pAb (ATL-HPA044603) Datasheet (External Link)
Vendor Page Anti HPSE2 pAb (ATL-HPA044603) at Atlas Antibodies

Documents & Links for Anti HPSE2 pAb (ATL-HPA044603)
Datasheet Anti HPSE2 pAb (ATL-HPA044603) Datasheet (External Link)
Vendor Page Anti HPSE2 pAb (ATL-HPA044603)



Citations for Anti HPSE2 pAb (ATL-HPA044603) – 1 Found
Kiyan, Yulia; Tkachuk, Sergey; Kurselis, Kestutis; Shushakova, Nelli; Stahl, Klaus; Dawodu, Damilola; Kiyan, Roman; Chichkov, Boris; Haller, Hermann. Heparanase-2 protects from LPS-mediated endothelial injury by inhibiting TLR4 signalling. Scientific Reports. 2019;9(1):13591.  PubMed