Anti HPSE2 pAb (ATL-HPA044603)

Atlas Antibodies

Catalog No.: ATL-HPA044603-25

Protein Description: heparanase 2 (inactive)
Gene Name: HPSE2
Alternative Gene Name: HPA2, HPR2, UFS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074852: 96%, ENSRNOG00000011852: 25%
Entrez Gene ID: 60495
Uniprot ID: Q8WWQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKQQFSNTY
• Gene Sequence: GKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKQQFSNTY
• Gene ID - Mouse: ENSMUSG00000074852
• Gene ID - Rat: ENSRNOG00000011852
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HPSE2 pAb (ATL-HPA044603) – 1 Found

Kiyan, Yulia; Tkachuk, Sergey; Kurselis, Kestutis; Shushakova, Nelli; Stahl, Klaus; Dawodu, Damilola; Kiyan, Roman; Chichkov, Boris; Haller, Hermann. Heparanase-2 protects from LPS-mediated endothelial injury by inhibiting TLR4 signalling. Scientific Reports. 2019;9(1):13591.